SCOP 1.73: Domain d1kx5a_: 1kx5 A:

Lineage for d1kx5a_ (1kx5 A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (5 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (4 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (23 PDB entries)

8. Domain d1kx5a_: 1kx5 A: [77593]
   Other proteins in same PDB: d1kx5b_, d1kx5c_, d1kx5d_, d1kx5f_, d1kx5g_, d1kx5h_

Details for d1kx5a_

PDB Entry: 1kx5, 1.94 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP147, at 1.9 A Resolution

PDB Compounds: (A:) histone h3

SCOP Domain Sequences for d1kx5a_:

Sequence; same for both SEQRES and ATOM records:

>d1kx5a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
artkqtarkstggkaprkqlatkaarksapatggvkkphryrpgtvalreirryqkstel
lirklpfqrlvreiaqdfktdlrfqssavmalqeaseaylvalfedtnlcaihakrvtim
pkdiqlarrirgera

Timeline for d1kx5a_:

• d1kx5a_ first appeared in SCOP 1.63
  
• d1kx5a_ appears in SCOP 1.71
  
• d1kx5a_ appears in SCOP 1.75
  
• d1kx5a_ appears in the current release, SCOPe 2.08