Lineage for d1kx4h_ (1kx4 H:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353075Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 353076Superfamily a.22.1: Histone-fold [47113] (3 families) (S)
  5. 353077Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
    form octamers composed of two copies of each of the four histones
  6. 353131Protein Histone H2B [47119] (3 species)
  7. 353132Species African clawed frog (Xenopus laevis) [TaxId:8355] [47121] (20 PDB entries)
  8. 353160Domain d1kx4h_: 1kx4 H: [77592]
    Other proteins in same PDB: d1kx4a_, d1kx4b_, d1kx4c_, d1kx4e_, d1kx4f_, d1kx4g_
    complexed with cl, mn

Details for d1kx4h_

PDB Entry: 1kx4 (more details), 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution

SCOP Domain Sequences for d1kx4h_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kx4h_ a.22.1.1 (H:) Histone H2B {African clawed frog (Xenopus laevis)}
trkesyaiyvykvlkqvhpdtgisskamsimnsfvndvferiageasrlahynkrstits
reiqtavrlllpgelakhavsegtkavtkytsak

SCOP Domain Coordinates for d1kx4h_:

Click to download the PDB-style file with coordinates for d1kx4h_.
(The format of our PDB-style files is described here.)

Timeline for d1kx4h_: