SCOP 1.67: Domain d1kx4a_: 1kx4 A:

Lineage for d1kx4a_ (1kx4 A:)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (3 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (4 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H3 [47122] (3 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (20 PDB entries)

8. Domain d1kx4a_: 1kx4 A: [77585]
   Other proteins in same PDB: d1kx4b_, d1kx4c_, d1kx4d_, d1kx4f_, d1kx4g_, d1kx4h_

Details for d1kx4a_

PDB Entry: 1kx4, 2.6 Å

PDB Description: X-Ray Structure of the Nucleosome Core Particle, NCP146b, at 2.6 A Resolution

SCOP Domain Sequences for d1kx4a_:

Sequence; same for both SEQRES and ATOM records:

>d1kx4a_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis)}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

Timeline for d1kx4a_:

• d1kx4a_ first appeared in SCOP 1.63
  
• d1kx4a_ appears in SCOP 1.65
  
• d1kx4a_ appears in SCOP 1.69
  
• d1kx4a_ appears in the current release, SCOPe 2.08