Lineage for d1kw0a_ (1kw0 A:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 265091Fold d.178: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56533] (1 superfamily)
    unusual fold
  4. 265092Superfamily d.178.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56534] (1 family) (S)
  5. 265093Family d.178.1.1: Aromatic aminoacid monoxygenases, catalytic and oligomerization domains [56535] (3 proteins)
  6. 265094Protein Phenylalanine hydroxylase, PAH [56538] (3 species)
  7. 265099Species Human (Homo sapiens) [TaxId:9606] [56539] (11 PDB entries)
  8. 265109Domain d1kw0a_: 1kw0 A: [77548]
    complexed with bh4, fe2, tih

Details for d1kw0a_

PDB Entry: 1kw0 (more details), 2.5 Å

PDB Description: catalytic domain of human phenylalanine hydroxylase (fe(ii)) in complex with tetrahydrobiopterin and thienylalanine

SCOP Domain Sequences for d1kw0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kw0a_ d.178.1.1 (A:) Phenylalanine hydroxylase, PAH {Human (Homo sapiens)}
vpwfprtiqeldrfanqilsygaeldadhpgfkdpvyrarrkqfadiaynyrhgqpiprv
eymeeekktwgtvfktlkslykthacyeynhifpllekycgfhednipqledvsqflqtc
tgfrlrpvagllssrdflgglafrvfhctqyirhgskpmytpepdichellghvplfsdr
sfaqfsqeiglaslgapdeyieklatiywftvefglckqgdsikaygagllssfgelqyc
lsekpkllplelektaiqnytvtefqplyyvaesfndakekvrnfaatiprpfsvrydpy
tqrievl

SCOP Domain Coordinates for d1kw0a_:

Click to download the PDB-style file with coordinates for d1kw0a_.
(The format of our PDB-style files is described here.)

Timeline for d1kw0a_: