Lineage for d1kt0a3 (1kt0 A:139-253)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2941336Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 2941337Superfamily d.26.1: FKBP-like [54534] (4 families) (S)
  5. 2941338Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)
  6. 2941437Protein FKBP51, N-terminal domains [82621] (2 species)
    duplication: tandem repeat of two FKBP domains
  7. 2941438Species Human (Homo sapiens) [TaxId:9606] [82622] (1 PDB entry)
  8. 2941440Domain d1kt0a3: 1kt0 A:139-253 [77527]
    Other proteins in same PDB: d1kt0a1
    complexed with so4

Details for d1kt0a3

PDB Entry: 1kt0 (more details), 2.7 Å

PDB Description: structure of the large fkbp-like protein, fkbp51, involved in steroid receptor complexes
PDB Compounds: (A:) 51 kda fk506-binding protein

SCOPe Domain Sequences for d1kt0a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kt0a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]}
gedlfedggiirrtkrkgegysnpnegatveihlegrcggrmfdcrdvaftvgegedhdi
pigidkalekmqreeqcilylgprygfgeagkpkfgiepnaeliyevtlksfeka

SCOPe Domain Coordinates for d1kt0a3:

Click to download the PDB-style file with coordinates for d1kt0a3.
(The format of our PDB-style files is described here.)

Timeline for d1kt0a3: