![]() | Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (2 families) ![]() |
![]() | Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (11 proteins) |
![]() | Protein FKBP51, N-terminal domains [82621] (2 species) duplication: tandem repeat of two FKBP domains |
![]() | Species Human (Homo sapiens) [TaxId:9606] [82622] (1 PDB entry) |
![]() | Domain d1kt0a3: 1kt0 A:139-253 [77527] Other proteins in same PDB: d1kt0a1 complexed with so4; mutant |
PDB Entry: 1kt0 (more details), 2.7 Å
SCOP Domain Sequences for d1kt0a3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kt0a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Human (Homo sapiens)} gedlfedggiirrtkrkgegysnpnegatveihlegrcggrmfdcrdvaftvgegedhdi pigidkalekmqreeqcilylgprygfgeagkpkfgiepnaeliyevtlksfeka
Timeline for d1kt0a3: