SCOP 1.67: Domain d1kf9f2: 1kf9 F:1629-1734

Lineage for d1kf9f2 (1kf9 F:1629-1734)

Root: SCOP 1.67
Class b: All beta proteins [48724] (141 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.2: Fibronectin type III [49265] (1 family)
Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
Protein Growth hormone receptor [49280] (1 species)
Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
tandem of fibronectin type III domains
Domain d1kf9f2: 1kf9 F:1629-1734 [77360]
Other proteins in same PDB: d1kf9a_, d1kf9d_

Details for d1kf9f2

PDB Entry: 1kf9 (more details), 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor

SCOP Domain Sequences for d1kf9f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf9f2 b.1.2.1 (F:1629-1734) Growth hormone receptor {Human (Homo sapiens)}
vqpdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkm
mdpilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlp

SCOP Domain Coordinates for d1kf9f2:

Click to download the PDB-style file with coordinates for d1kf9f2.
(The format of our PDB-style files is described here.)

Timeline for d1kf9f2: