Lineage for d1kf9c2 (1kf9 C:629-734)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 366660Superfamily b.1.2: Fibronectin type III [49265] (1 family) (S)
  5. 366661Family b.1.2.1: Fibronectin type III [49266] (22 proteins)
  6. 366778Protein Growth hormone receptor [49280] (1 species)
  7. 366779Species Human (Homo sapiens) [TaxId:9606] [49281] (6 PDB entries)
    tandem of fibronectin type III domains
  8. 366791Domain d1kf9c2: 1kf9 C:629-734 [77355]
    Other proteins in same PDB: d1kf9a_, d1kf9d_

Details for d1kf9c2

PDB Entry: 1kf9 (more details), 2.6 Å

PDB Description: phage display derived variant of human growth hormone complexed with two copies of the extracellular domain of its receptor

SCOP Domain Sequences for d1kf9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kf9c2 b.1.2.1 (C:629-734) Growth hormone receptor {Human (Homo sapiens)}
vqpdppialnwtllnvsltgihadiqvrweaprnadiqkgwmvleyelqykevnetkwkm
mdpilttsvpvyslkvdkeyevrvrskqrnsgnygefsevlyvtlp

SCOP Domain Coordinates for d1kf9c2:

Click to download the PDB-style file with coordinates for d1kf9c2.
(The format of our PDB-style files is described here.)

Timeline for d1kf9c2: