SCOPe 2.04: Domain d1jycb_: 1jyc B:

Lineage for d1jycb_ (1jyc B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Concanavalin A [49901] (4 species)
   natural circle permutation: the "old" N- and C-termini are linked with a peptide bond, whereas the "new" ones correspond to a cleaved loop

7. Species Jack bean (Canavalia ensiformis) [TaxId:3823] [49902] (56 PDB entries)
   Uniprot P81461

8. Domain d1jycb_: 1jyc B: [77209]
   complexed with a carbohydrate-mimicking 15-mer peptide
   complexed with ca, mn

Details for d1jycb_

PDB Entry: 1jyc, 2.75 Å

PDB Description: concanavalin a/15-mer peptide complex

PDB Compounds: (B:) concanavalin a

SCOPe Domain Sequences for d1jycb_:

Sequence; same for both SEQRES and ATOM records:

>d1jycb_ b.29.1.1 (B:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]}
adtivaveldtypntdigdpsyphigidiksvrskktakwnmqngkvgtahiiynsvdkr
lsavvsypnadsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
iwessavvasfeatftflikspdshpadgiaffisnidssipsgstgrllglfpdan

Timeline for d1jycb_:

• d1jycb_ first appeared in SCOP 1.63
  
• d1jycb_ appears in SCOPe 2.03
  
• d1jycb_ appears in SCOPe 2.05
  
• d1jycb_ appears in the current release, SCOPe 2.08