SCOPe 2.04: Domain d1jxnc_: 1jxn C:

Lineage for d1jxnc_ (1jxn C:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)

8. Domain d1jxnc_: 1jxn C: [77204]
   complexed with ca, mfu, mn, mrd

Details for d1jxnc_

PDB Entry: 1jxn, 2.3 Å

PDB Description: crystal structure of the lectin i from ulex europaeus in complex with the methyl glycoside of alpha-l-fucose

PDB Compounds: (C:) anti-H(O) lectin I

SCOPe Domain Sequences for d1jxnc_:

Sequence; same for both SEQRES and ATOM records:

>d1jxnc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

Timeline for d1jxnc_:

• d1jxnc_ first appeared in SCOP 1.63
  
• d1jxnc_ appears in SCOPe 2.03
  
• d1jxnc_ appears in SCOPe 2.05
  
• d1jxnc_ appears in the current release, SCOPe 2.08