Lineage for d1jxnc_ (1jxn C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042434Species Furze (Ulex europaeus), UEA-I [TaxId:3902] [49917] (2 PDB entries)
  8. 2042439Domain d1jxnc_: 1jxn C: [77204]
    complexed with ca, mfu, mn, mrd

Details for d1jxnc_

PDB Entry: 1jxn (more details), 2.3 Å

PDB Description: Crystal Structure of the Lectin I from Ulex europaeus in complex with the methyl glycoside of alpha-L-fucose
PDB Compounds: (C:) anti-H(O) lectin I

SCOPe Domain Sequences for d1jxnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jxnc_ b.29.1.1 (C:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]}
sddlsfkfknfsqngkdlsfqgnasvietgvlqlnkvgnnlpdetggiaryiapihiwnc
ntgelasfitsfsffmetsanpkaatdgltfflappdsplrraggyfglfndtkcdssyq
tvavefdtigspvnfwdpgfphigidvncvksinaerwnkryglnnvanveiiyeasskt
ltasltypsdqtsisvtsivdlkeilpewvsvgfsgstyigrqathevlnwyftstfint

SCOPe Domain Coordinates for d1jxnc_:

Click to download the PDB-style file with coordinates for d1jxnc_.
(The format of our PDB-style files is described here.)

Timeline for d1jxnc_: