Lineage for d1jvsb3 (1jvs B:126-274)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1033075Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1033076Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1033423Family d.81.1.3: Dihydrodipicolinate reductase-like [55368] (6 proteins)
  6. 1033424Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69770] (2 species)
  7. 1033425Species Escherichia coli [TaxId:562] [69771] (11 PDB entries)
    Uniprot P45568
  8. 1033430Domain d1jvsb3: 1jvs B:126-274 [77192]
    Other proteins in same PDB: d1jvsa1, d1jvsa2, d1jvsb1, d1jvsb2
    complexed with ndp, so4

Details for d1jvsb3

PDB Entry: 1jvs (more details), 2.2 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase; a target enzyme for antimalarial drugs
PDB Compounds: (B:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1jvsb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvsb3 d.81.1.3 (B:126-274) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
slvtcgrlfmdavkqskaqllpvdsehnaifqslpqpiqhnlgyadleqngvvsilltgs
ggpfretplrdlatmtpdqacrhpnwsmgrkisvdsatmmnkgleyiearwlfnasasqm
evlihpqsvihsmvryqdgsvlaqlgepd

SCOPe Domain Coordinates for d1jvsb3:

Click to download the PDB-style file with coordinates for d1jvsb3.
(The format of our PDB-style files is described here.)

Timeline for d1jvsb3: