Lineage for d1ju5a_ (1ju5 A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 508336Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 508337Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 508338Family d.93.1.1: SH2 domain [55551] (30 proteins)
    Pfam 00017
  6. 508442Protein Crk proto-oncogen [82741] (1 species)
  7. 508443Species Human (Homo sapiens) [TaxId:9606] [82742] (1 PDB entry)
  8. 508444Domain d1ju5a_: 1ju5 A: [77173]
    Other proteins in same PDB: d1ju5c_
    complex with the Crk-derived phophopeptide and Abl SH3 domain

Details for d1ju5a_

PDB Entry: 1ju5 (more details)

PDB Description: ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy

SCOP Domain Sequences for d1ju5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju5a_ d.93.1.1 (A:) Crk proto-oncogen {Human (Homo sapiens)}
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr

SCOP Domain Coordinates for d1ju5a_:

Click to download the PDB-style file with coordinates for d1ju5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ju5a_: