Lineage for d1ju5a_ (1ju5 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2965227Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices
  4. 2965228Superfamily d.93.1: SH2 domain [55550] (2 families) (S)
  5. 2965229Family d.93.1.1: SH2 domain [55551] (35 proteins)
    Pfam PF00017
  6. 2965360Protein Crk proto-oncogen [82741] (1 species)
  7. 2965361Species Human (Homo sapiens) [TaxId:9606] [82742] (2 PDB entries)
  8. 2965362Domain d1ju5a_: 1ju5 A: [77173]
    Other proteins in same PDB: d1ju5c_
    complex with the Crk-derived phophopeptide and Abl SH3 domain

Details for d1ju5a_

PDB Entry: 1ju5 (more details)

PDB Description: ternary complex of an crk sh2 domain, crk-derived phophopeptide, and abl sh3 domain by nmr spectroscopy
PDB Compounds: (A:) Crk

SCOPe Domain Sequences for d1ju5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ju5a_ d.93.1.1 (A:) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]}
swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv
ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr

SCOPe Domain Coordinates for d1ju5a_:

Click to download the PDB-style file with coordinates for d1ju5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ju5a_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ju5c_