Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.93: SH2-like [55549] (1 superfamily) 3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices |
Superfamily d.93.1: SH2 domain [55550] (2 families) |
Family d.93.1.1: SH2 domain [55551] (35 proteins) Pfam PF00017 |
Protein Crk proto-oncogen [82741] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [82742] (2 PDB entries) |
Domain d1ju5a_: 1ju5 A: [77173] Other proteins in same PDB: d1ju5c_ complex with the Crk-derived phophopeptide and Abl SH3 domain |
PDB Entry: 1ju5 (more details)
SCOPe Domain Sequences for d1ju5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ju5a_ d.93.1.1 (A:) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} swywgrlsrqeavallqgqrhgvflvrdsstspgdyvlsvsensrvshyiinssgprppv ppspaqpppgvspsrlrigdqefdslpallefykihyldtttliepvsr
Timeline for d1ju5a_: