Lineage for d1jo0a_ (1jo0 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2563801Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2564120Superfamily d.68.4: YhbY-like [75471] (1 family) (S)
    automatically mapped to Pfam PF01985
  5. 2564121Family d.68.4.1: YhbY-like [75472] (3 proteins)
    Pfam PF01985
  6. 2564128Protein YhbY homologue HI1333 [82702] (1 species)
  7. 2564129Species Haemophilus influenzae [TaxId:727] [82703] (1 PDB entry)
  8. 2564130Domain d1jo0a_: 1jo0 A: [77140]
    structural genomics
    complexed with gol

Details for d1jo0a_

PDB Entry: 1jo0 (more details), 1.37 Å

PDB Description: structure of hi1333, a hypothetical protein from haemophilus influenzae with structural similarity to rna-binding proteins
PDB Compounds: (A:) hypothetical protein hi1333

SCOPe Domain Sequences for d1jo0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jo0a_ d.68.4.1 (A:) YhbY homologue HI1333 {Haemophilus influenzae [TaxId: 727]}
ttlstkqkqflkglahhlnpvvmlggngltegvlaeienalnhhelikvkvagadretkq
liinaivretkaaqvqtighilvlyrpseeakiqlpr

SCOPe Domain Coordinates for d1jo0a_:

Click to download the PDB-style file with coordinates for d1jo0a_.
(The format of our PDB-style files is described here.)

Timeline for d1jo0a_: