SCOPe 2.08: Domain d1jo0a_: 1jo0 A:

Lineage for d1jo0a_ (1jo0 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.68: IF3-like [55199] (8 superfamilies)
   beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest

4. Superfamily d.68.4: YhbY-like [75471] (1 family)
   automatically mapped to Pfam PF01985

5. Family d.68.4.1: YhbY-like [75472] (3 proteins)
   Pfam PF01985

6. Protein YhbY homologue HI1333 [82702] (1 species)

7. Species Haemophilus influenzae [TaxId:727] [82703] (1 PDB entry)

8. Domain d1jo0a_: 1jo0 A: [77140]
   structural genomics
   complexed with gol

Details for d1jo0a_

PDB Entry: 1jo0, 1.37 Å

PDB Description: structure of hi1333, a hypothetical protein from haemophilus influenzae with structural similarity to rna-binding proteins

PDB Compounds: (A:) hypothetical protein hi1333

SCOPe Domain Sequences for d1jo0a_:

Sequence; same for both SEQRES and ATOM records:

>d1jo0a_ d.68.4.1 (A:) YhbY homologue HI1333 {Haemophilus influenzae [TaxId: 727]}
ttlstkqkqflkglahhlnpvvmlggngltegvlaeienalnhhelikvkvagadretkq
liinaivretkaaqvqtighilvlyrpseeakiqlpr

Timeline for d1jo0a_:

• d1jo0a_ first appeared in SCOP 1.63
  
• d1jo0a_ appears in SCOPe 2.07