Lineage for d1j6pa1 (1j6p A:-1-49,A:331-405)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382243Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
    pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns
  4. 382244Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (7 families) (S)
    this domain is interrupted by the catalytic beta/alpha barrel domain
  5. 382327Family b.92.1.4: Hypothetical protein TM0936 [82224] (1 protein)
  6. 382328Protein Hypothetical protein TM0936 [82225] (1 species)
  7. 382329Species Thermotoga maritima [TaxId:243274] [82226] (2 PDB entries)
  8. 382331Domain d1j6pa1: 1j6p A:-1-49,A:331-405 [77089]
    Other proteins in same PDB: d1j6pa2
    structural genomics
    complexed with mse, ni

Details for d1j6pa1

PDB Entry: 1j6p (more details), 1.9 Å

PDB Description: crystal structure of metal-dependent hydrolase of cytosinedemaniase/chlorohydrolase family (tm0936) from thermotoga maritima at 1.9 a resolution

SCOP Domain Sequences for d1j6pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j6pa1 b.92.1.4 (A:-1-49,A:331-405) Hypothetical protein TM0936 {Thermotoga maritima}
hhmiignclilkdfssepfwgaveiengtikrvlqgevkvdldlsgklvmpXkieegwna
dlvvidldlpemfpvqniknhlvhafsgevfatmvagkwiyfdgeyptidseevkrelar
iekelys

SCOP Domain Coordinates for d1j6pa1:

Click to download the PDB-style file with coordinates for d1j6pa1.
(The format of our PDB-style files is described here.)

Timeline for d1j6pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1j6pa2