SCOPe 2.06: Domain d1j53a_: 1j53 A:

Lineage for d1j53a_ (1j53 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species)

7. Species Escherichia coli [TaxId:562] [82445] (2 PDB entries)

8. Domain d1j53a_: 1j53 A: [77076]
   complexed with edo, mn, tmp

Details for d1j53a_

PDB Entry: 1j53, 1.8 Å

PDB Description: Structure of the N-terminal Exonuclease Domain of the Epsilon Subunit of E.coli DNA Polymerase III at pH 8.5

PDB Compounds: (A:) DNA polymerase III, epsilon chain

SCOPe Domain Sequences for d1j53a_:

Sequence; same for both SEQRES and ATOM records:

>d1j53a_ c.55.3.5 (A:) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli [TaxId: 562]}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

Timeline for d1j53a_:

• d1j53a_ first appeared in SCOP 1.63
  
• d1j53a_ appears in SCOPe 2.05
  
• d1j53a_ appears in SCOPe 2.07
  
• d1j53a_ appears in the current release, SCOPe 2.08