Lineage for d1j53a_ (1j53 A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 246267Superfamily c.55.3: Ribonuclease H-like [53098] (7 families) (S)
    consists of one domain of this fold
  5. 246466Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (5 proteins)
  6. 246530Protein N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III [82444] (1 species)
  7. 246531Species Escherichia coli [TaxId:562] [82445] (2 PDB entries)
  8. 246533Domain d1j53a_: 1j53 A: [77076]
    complexed with egl, mn, tmp

Details for d1j53a_

PDB Entry: 1j53 (more details), 1.8 Å

PDB Description: Structure of the N-terminal Exonuclease Domain of the Epsilon Subunit of E.coli DNA Polymerase III at pH 8.5

SCOP Domain Sequences for d1j53a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j53a_ c.55.3.5 (A:) N-terminal exonuclease domain of the epsilon subunit of DNA polymerase III {Escherichia coli}
rqivldtettgmnqigahyeghkiieigavevvnrrltgnnfhvylkpdrlvdpeafgvh
giadeflldkptfaevadefmdyirgaelvihnaafdigfmdyefsllkrdipktntfck
vtdslavarkmfpgkrnsldalcaryeidnskrtlhgalldaqilaevylamtg

SCOP Domain Coordinates for d1j53a_:

Click to download the PDB-style file with coordinates for d1j53a_.
(The format of our PDB-style files is described here.)

Timeline for d1j53a_: