Class b: All beta proteins [48724] (119 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (40 proteins) |
Protein Trypsin(ogen) [50515] (8 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [50518] (30 PDB entries) |
Domain d1j16a_: 1j16 A: [77054] complexed with ben, ca, so4; mutant |
PDB Entry: 1j16 (more details), 1.6 Å
SCOP Domain Sequences for d1j16a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j16a_ b.47.1.2 (A:) Trypsin(ogen) {Rat (Rattus norvegicus)} ivggytcqensvpyqvslnsgyhfcggslindqwvvsaahcyksriqvrlgehninvleg neqfvnaakiikhpnfdretynndimliklsspvklnarvatvalpsscapagtqclisg wgntlssgvnepdllqcldapllpqadceasssfiitdnmvcvgfleggkdacqgdsggp vvcngelqgivswgygcalpdnpgvytkvcnyvdwiqdtiaan
Timeline for d1j16a_: