Lineage for d1izlf_ (1izl F:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1249828Fold i.5: Photosystems [58155] (1 superfamily)
  4. 1249829Superfamily i.5.1: Photosystems [58156] (1 family) (S)
  5. 1249830Family i.5.1.1: Photosystems [58157] (5 proteins)
    not a true family
  6. 1249844Protein Photosystem II [58160] (2 species)
    there is a higher resolution structure of Thermosynechococcus elongatus photosystem II (1s5l); however, PDB entry 1S5L designates protein chains by both upper case and lower case letters creating problems with its processing and presentation; there are two copies of the photosystem II complex: one with the upper case chains and the other with lower case chains
  7. 1249882Species Thermosynechococcus vulcanus [TaxId:32053] [82945] (2 PDB entries)
  8. 1249904Domain d1izlf_: 1izl F: [76999]
    complexed with bcr, cla, fe, hem, mn, pho, pla

Details for d1izlf_

PDB Entry: 1izl (more details), 3.7 Å

PDB Description: crystal structure of photosystem ii
PDB Compounds: (F:) photosystem II: subunit psbf

SCOPe Domain Sequences for d1izlf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1izlf_ i.5.1.1 (F:) Photosystem II {Thermosynechococcus vulcanus [TaxId: 32053]}
piftvrwvavhtlavptifflgaiaamqfi

SCOPe Domain Coordinates for d1izlf_:

Click to download the PDB-style file with coordinates for d1izlf_.
(The format of our PDB-style files is described here.)

Timeline for d1izlf_: