SCOPe 2.08: Domain d1iylc2: 1iyl C:225-451

Lineage for d1iylc2 (1iyl C:225-451)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
   duplication: consists of two NAT-like domains swapped with the C-terminal strands

6. Protein N-myristoyl transferase, NMT [55749] (4 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)

8. Domain d1iylc2: 1iyl C:225-451 [76967]
   complexed with r64

Details for d1iylc2

PDB Entry: 1iyl, 3.2 Å

PDB Description: Crystal Structure of Candida albicans N-myristoyltransferase with Non-peptidic Inhibitor

PDB Compounds: (C:) Myristoyl-CoA:Protein N-Myristoyltransferase

SCOPe Domain Sequences for d1iylc2:

Sequence; same for both SEQRES and ATOM records:

>d1iylc2 d.108.1.2 (C:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

Timeline for d1iylc2:

• d1iylc2 first appeared in SCOP 1.63
  
• d1iylc2 appears in SCOPe 2.07