Lineage for d1iylb2 (1iyl B:225-451)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209616Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2209617Protein N-myristoyl transferase, NMT [55749] (3 species)
  7. 2209636Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)
  8. 2209650Domain d1iylb2: 1iyl B:225-451 [76965]
    complexed with r64

Details for d1iylb2

PDB Entry: 1iyl (more details), 3.2 Å

PDB Description: Crystal Structure of Candida albicans N-myristoyltransferase with Non-peptidic Inhibitor
PDB Compounds: (B:) Myristoyl-CoA:Protein N-Myristoyltransferase

SCOPe Domain Sequences for d1iylb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iylb2 d.108.1.2 (B:225-451) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
yqhrpinwsklhdvgfshlppnqtkssmvasytlpnnpklkglrpmtgkdvstvlsllyk
yqerfdivqlfteeefkhwmlghdensdsnvvksyvvedengiitdyfsyyllpftvldn
aqhdelgiaylfyyasdsfekpnykkrlnelitdalitskkfgvdvfncltcqdntyflk
dckfgsgdgflnyylfnyrtfpmdggidkktkevvedqtsgigvvll

SCOPe Domain Coordinates for d1iylb2:

Click to download the PDB-style file with coordinates for d1iylb2.
(The format of our PDB-style files is described here.)

Timeline for d1iylb2: