Lineage for d1iykb1 (1iyk B:60-224)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968821Family d.108.1.2: N-myristoyl transferase, NMT [55748] (1 protein)
    duplication: consists of two NAT-like domains swapped with the C-terminal strands
  6. 2968822Protein N-myristoyl transferase, NMT [55749] (4 species)
  7. 2968848Species Yeast (Candida albicans) [TaxId:5476] [55751] (3 PDB entries)
  8. 2968851Domain d1iykb1: 1iyk B:60-224 [76960]
    complexed with mim, mya

Details for d1iykb1

PDB Entry: 1iyk (more details), 2.3 Å

PDB Description: Crystal structure of candida albicans N-myristoyltransferase with myristoyl-COA and peptidic inhibitor
PDB Compounds: (B:) Myristoyl-CoA:Protein N-Myristoyltransferase

SCOPe Domain Sequences for d1iykb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iykb1 d.108.1.2 (B:60-224) N-myristoyl transferase, NMT {Yeast (Candida albicans) [TaxId: 5476]}
egpidklktpedvpndplplisdfewstldiddnlqldelykllydnyvedidatfrfky
sheffqwalkppgwrkdwhvgvrvkstgklvafiaatpvtfklnksnkvidsveinflci
hkklrnkrlapvlikeitrrvnkqniwqalytggsilptplttcr

SCOPe Domain Coordinates for d1iykb1:

Click to download the PDB-style file with coordinates for d1iykb1.
(The format of our PDB-style files is described here.)

Timeline for d1iykb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iykb2