SCOPe 2.05: Domain d1iwpm_: 1iwp M:

Lineage for d1iwpm_ (1iwp M:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.23: Open three-helical up-and-down bundle [47143] (7 superfamilies)
   core: 3 helices; bundle, open

4. Superfamily a.23.2: Diol dehydratase, gamma subunit [47148] (1 family)
   contains irregular N-terminal subdomain
   automatically mapped to Pfam PF02287

5. Family a.23.2.1: Diol dehydratase, gamma subunit [47149] (1 protein)

6. Protein Diol dehydratase, gamma subunit [47150] (2 species)

7. Species Klebsiella pneumoniae [TaxId:573] [81728] (2 PDB entries)

8. Domain d1iwpm_: 1iwp M: [76889]
   Other proteins in same PDB: d1iwpa_, d1iwpb_, d1iwpe_, d1iwpl_
   complexed with b12, k, pgo

Details for d1iwpm_

PDB Entry: 1iwp, 2.1 Å

PDB Description: Glycerol Dehydratase-cyanocobalamin Complex of Klebsiella pneumoniae

PDB Compounds: (M:) Glycerol Dehydratase Gamma subunit

SCOPe Domain Sequences for d1iwpm_:

Sequence; same for both SEQRES and ATOM records:

>d1iwpm_ a.23.2.1 (M:) Diol dehydratase, gamma subunit {Klebsiella pneumoniae [TaxId: 573]}
ktmrvqdyplatrcpehiltptgkpltditlekvlsgevgpqdvrisrqtleyqaqiaeq
mqrhavarnfrraaeliaipderilaiynalrpfrssqaellaiadelehtwhatvnaaf
vresaevyqqrhklrkgs

Timeline for d1iwpm_:

• d1iwpm_ first appeared in SCOP 1.63
  
• d1iwpm_ appears in SCOPe 2.04
  
• d1iwpm_ appears in SCOPe 2.06
  
• d1iwpm_ appears in the current release, SCOPe 2.08