Lineage for d1ivsa3 (1ivs A:190-342)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412055Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 2412056Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 2412057Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 2412078Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species)
  7. 2412079Species Thermus thermophilus [TaxId:274] [50683] (3 PDB entries)
  8. 2412080Domain d1ivsa3: 1ivs A:190-342 [76857]
    Other proteins in same PDB: d1ivsa1, d1ivsa2, d1ivsa4, d1ivsb1, d1ivsb2, d1ivsb4
    protein/RNA complex; complexed with vaa

Details for d1ivsa3

PDB Entry: 1ivs (more details), 2.9 Å

PDB Description: crystal structure of thermus thermophilus valyl-trna synthetase complexed with trna(val) and valyl-adenylate analogue
PDB Compounds: (A:) valyl-tRNA synthetase

SCOPe Domain Sequences for d1ivsa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivsa3 b.51.1.1 (A:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus [TaxId: 274]}
teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte
vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal
rgldrfearrkavelfreaghlvkeedytiala

SCOPe Domain Coordinates for d1ivsa3:

Click to download the PDB-style file with coordinates for d1ivsa3.
(The format of our PDB-style files is described here.)

Timeline for d1ivsa3: