| Class b: All beta proteins [48724] (119 folds) |
| Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) ![]() |
| Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (3 proteins) inserted into the catalytic domain |
| Protein Valyl-tRNA synthetase (ValRS) [50682] (1 species) |
| Species Thermus thermophilus [TaxId:274] [50683] (2 PDB entries) |
| Domain d1ivsa3: 1ivs A:190-342 [76857] Other proteins in same PDB: d1ivsa1, d1ivsa2, d1ivsa4, d1ivsb1, d1ivsb2, d1ivsb4 |
PDB Entry: 1ivs (more details), 2.9 Å
SCOP Domain Sequences for d1ivsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ivsa3 b.51.1.1 (A:190-342) Valyl-tRNA synthetase (ValRS) {Thermus thermophilus}
teptpgklytlryevegggfieiatvrpetvfadqaiavhpederyrhllgkrariplte
vwipiladpavekdfgtgalkvtpahdpldyeigerhglkpvsvinlegrmegervpeal
rgldrfearrkavelfreaghlvkeedytiala
Timeline for d1ivsa3:
View in 3DDomains from other chains: (mouse over for more information) d1ivsb1, d1ivsb2, d1ivsb3, d1ivsb4 |