| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein) |
| Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (3 species) |
| Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries) |
| Domain d1iv4e_: 1iv4 E: [76838] |
PDB Entry: 1iv4 (more details), 1.55 Å
SCOP Domain Sequences for d1iv4e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv4e_ d.79.5.1 (E:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld
Timeline for d1iv4e_: