| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
| Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
| Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
| Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries) |
| Domain d1iv2a_: 1iv2 A: [76822] complexed with cdp, mg |
PDB Entry: 1iv2 (more details), 1.55 Å
SCOPe Domain Sequences for d1iv2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv2a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld
Timeline for d1iv2a_: