SCOPe 2.07: Domain d1iv2c_: 1iv2 C:

Lineage for d1iv2c_ (1iv2 C:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.1: IpsF-like [69766] (3 proteins)
   automatically mapped to Pfam PF02542

6. Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species)

7. Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries)

8. Domain d1iv2c_: 1iv2 C: [76824]
   complexed with cdp, mg

Details for d1iv2c_

PDB Entry: 1iv2, 1.55 Å

PDB Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase (bound form cdp)

PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d1iv2c_:

Sequence; same for both SEQRES and ATOM records:

>d1iv2c_ d.79.5.1 (C:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]}
rigygedshrleegrplylcgllipspvgalahsdgdaamhaltdallsayglgdigllf
pdtdprwrgersevflreamrlveargakllqaslvltldrpklgphrkalvdslsrlmr
lpqdrigltfktseglapshvqaravvlld

Timeline for d1iv2c_:

• d1iv2c_ first appeared in SCOP 1.63
  
• d1iv2c_ appears in SCOPe 2.06
  
• d1iv2c_ appears in the current release, SCOPe 2.08