![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
![]() | Superfamily d.79.5: IpsF-like [69765] (2 families) ![]() forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1) |
![]() | Family d.79.5.1: IpsF-like [69766] (3 proteins) automatically mapped to Pfam PF02542 |
![]() | Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (6 species) |
![]() | Species Thermus thermophilus [TaxId:274] [82720] (4 PDB entries) |
![]() | Domain d1iv1a_: 1iv1 A: [76816] |
PDB Entry: 1iv1 (more details), 1.65 Å
SCOPe Domain Sequences for d1iv1a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iv1a_ d.79.5.1 (A:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Thermus thermophilus [TaxId: 274]} rigygedshrleegrplylcgllipspvgalahsdgdaalhaltdallsayglgdigllf pdtdprwrgersevflrealrlveargakllqaslvltldrpklgphrkalvdslsrllr lpqdrigltfktseglapshvqaravvlld
Timeline for d1iv1a_: