Lineage for d1is6a_ (1is6 A:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 226527Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 226528Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) (S)
  5. 226891Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins)
  6. 226902Protein Congerin II [82034] (1 species)
  7. 226903Species Conger eel (Conger myriaster) [TaxId:7943] [82035] (4 PDB entries)
  8. 226905Domain d1is6a_: 1is6 A: [76776]
    complexed with mes

Details for d1is6a_

PDB Entry: 1is6 (more details), 1.7 Å

PDB Description: MES-Liganded Congerin II

SCOP Domain Sequences for d1is6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1is6a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster)}
draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln
slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli
ylagdarltfvrle

SCOP Domain Coordinates for d1is6a_:

Click to download the PDB-style file with coordinates for d1is6a_.
(The format of our PDB-style files is described here.)

Timeline for d1is6a_: