Class b: All beta proteins [48724] (119 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.3: Galectin (animal S-lectin) [49932] (5 proteins) |
Protein Congerin II [82034] (1 species) |
Species Conger eel (Conger myriaster) [TaxId:7943] [82035] (4 PDB entries) |
Domain d1is6a_: 1is6 A: [76776] complexed with mes |
PDB Entry: 1is6 (more details), 1.7 Å
SCOP Domain Sequences for d1is6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1is6a_ b.29.1.3 (A:) Congerin II {Conger eel (Conger myriaster)} draevrnipfklgmyltvggvvnsnatrfsinvgestdsiamhmdhrfsygadqnvlvln slvhnvgwqqeerskkfpftkgdhfqttitfdthtfyiqlsngetvefpnrnkdaafnli ylagdarltfvrle
Timeline for d1is6a_: