SCOPe 2.04: Domain d1iq6a_: 1iq6 A:

Lineage for d1iq6a_ (1iq6 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.4: MaoC-like [82636] (6 proteins)

6. Protein (R)-specific enoyl-CoA hydratase [82637] (1 species)
   involved in polyhydroxyalkanoate (PHA) biosynthesis

7. Species Aeromonas caviae [TaxId:648] [82638] (1 PDB entry)

8. Domain d1iq6a_: 1iq6 A: [76755]
   complexed with ipa

Details for d1iq6a_

PDB Entry: 1iq6, 1.5 Å

PDB Description: (r)-hydratase from a. caviae involved in pha biosynthesis

PDB Compounds: (A:) (r)-specific enoyl-coa hydratase

SCOPe Domain Sequences for d1iq6a_:

Sequence; same for both SEQRES and ATOM records:

>d1iq6a_ d.38.1.4 (A:) (R)-specific enoyl-CoA hydratase {Aeromonas caviae [TaxId: 648]}
aqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllaslf
sgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgga
lavtgeavvklp

Timeline for d1iq6a_:

• d1iq6a_ first appeared in SCOP 1.63
  
• d1iq6a_ appears in SCOPe 2.03
  
• d1iq6a_ appears in SCOPe 2.05
  
• d1iq6a_ appears in the current release, SCOPe 2.08