PDB entry 1iq6

View 1iq6 on RCSB PDB site
Description: (r)-hydratase from a. caviae involved in pha biosynthesis
Class: lyase
Keywords: hydratase, (R)-hydratase, enoyl-CoA hydratase, polyhydroxyalkanoate, Aeromonas caviae, the hydratase 2 motif, LYASE
Deposited on 2001-06-18, released 2003-02-18
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.203
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: (r)-specific enoyl-coa hydratase
    Species: Aeromonas punctata [TaxId:648]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1iq6a_
  • Chain 'B':
    Compound: (r)-specific enoyl-coa hydratase
    Species: Aeromonas punctata [TaxId:648]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1iq6b_
  • Heterogens: IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1iq6A (A:)
    msaqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllas
    lfsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqg
    galavtgeavvklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iq6A (A:)
    aqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllaslf
    sgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgga
    lavtgeavvklp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1iq6B (B:)
    msaqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllas
    lfsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqg
    galavtgeavvklp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1iq6B (B:)
    saqslevgqkarlskrfgaaevaafaalsedfnplhldpafaattaferpivhgmllasl
    fsgllgqqlpgkgsiylgqslsfklpvfvgdevtaevevtalredkpiatlttriftqgg
    alavtgeavvklp