Lineage for d1h64p_ (1h64 P:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539178Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 1539179Protein Archaeal homoheptameric Sm protein [63758] (6 species)
  7. 1539290Species Pyrococcus abyssi [TaxId:29292] [82089] (2 PDB entries)
  8. 1539308Domain d1h64p_: 1h64 P: [76692]

Details for d1h64p_

PDB Entry: 1h64 (more details), 1.9 Å

PDB Description: crystal structure of the sm-related protein of p. abyssi the biological unit is a heptamer
PDB Compounds: (P:) snrnp sm-like protein

SCOPe Domain Sequences for d1h64p_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h64p_ b.38.1.1 (P:) Archaeal homoheptameric Sm protein {Pyrococcus abyssi [TaxId: 29292]}
erpldvihrsldkdvlvilkkgfefrgrligydihlnvvladaemiqdgevvkrygkivi
rgdnvlaispt

SCOPe Domain Coordinates for d1h64p_:

Click to download the PDB-style file with coordinates for d1h64p_.
(The format of our PDB-style files is described here.)

Timeline for d1h64p_: