SCOPe 2.07: Domain d1h32a2: 1h32 A:151-261

Lineage for d1h32a2 (1h32 A:151-261)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
   two-domain cytochrome c with novel domain arrangement

6. Protein Di-heme cytochrome c SoxA [81678] (1 species)
   cysteine persulfide(cys sulfane) heme coordination

7. Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)

8. Domain d1h32a2: 1h32 A:151-261 [76619]
   Other proteins in same PDB: d1h32b_
   complexed with edo, hec

Details for d1h32a2

PDB Entry: 1h32, 1.5 Å

PDB Description: reduced soxax complex from rhodovulum sulfidophilum

PDB Compounds: (A:) diheme cytochrome c

SCOPe Domain Sequences for d1h32a2:

Sequence; same for both SEQRES and ATOM records:

>d1h32a2 a.3.1.8 (A:151-261) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
idgpaqstwekgreiyytrygqldlscascheqyfdhyiradhlsqgqingfpsyrlkna
rlnavhdrfrgcirdtrgvpfavgspefvalelyvasrgnglsvegpsvrn

Timeline for d1h32a2:

• d1h32a2 first appeared in SCOP 1.63
  
• d1h32a2 appears in SCOPe 2.06
  
• d1h32a2 appears in the current release, SCOPe 2.08