Lineage for d1h32a1 (1h32 A:1-150)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2304252Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2304253Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2305043Family a.3.1.8: Di-heme cytochrome c SoxA [81677] (1 protein)
    two-domain cytochrome c with novel domain arrangement
  6. 2305044Protein Di-heme cytochrome c SoxA [81678] (1 species)
    cysteine persulfide(cys sulfane) heme coordination
  7. 2305045Species Rhodovulum sulfidophilum [TaxId:35806] [81679] (4 PDB entries)
  8. 2305046Domain d1h32a1: 1h32 A:1-150 [76618]
    Other proteins in same PDB: d1h32b_
    complexed with edo, hec

Details for d1h32a1

PDB Entry: 1h32 (more details), 1.5 Å

PDB Description: reduced soxax complex from rhodovulum sulfidophilum
PDB Compounds: (A:) diheme cytochrome c

SCOPe Domain Sequences for d1h32a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h32a1 a.3.1.8 (A:1-150) Di-heme cytochrome c SoxA {Rhodovulum sulfidophilum [TaxId: 35806]}
gpddplvingeieivtraptpahladrfdeirsgwtfrtddtqalemddfensgmvfvee
aravwdrpegtegkacadchgavddgmyglravypkyvesagkvrtveqminacrtsrmg
apewdyigpdmtamvaliasvsrgmpvsva

SCOPe Domain Coordinates for d1h32a1:

Click to download the PDB-style file with coordinates for d1h32a1.
(The format of our PDB-style files is described here.)

Timeline for d1h32a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1h32a2
View in 3D
Domains from other chains:
(mouse over for more information)
d1h32b_