Lineage for d1h28a_ (1h28 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419158Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 419159Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 419200Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 419321Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
    CMGC group; CDKs subfamily; serine/threonine kinase
  7. 419331Species Human (Homo sapiens) [TaxId:9606] [88856] (73 PDB entries)
  8. 419424Domain d1h28a_: 1h28 A: [76540]
    Other proteins in same PDB: d1h28b1, d1h28b2, d1h28d1, d1h28d2

Details for d1h28a_

PDB Entry: 1h28 (more details), 2.8 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p107

SCOP Domain Sequences for d1h28a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1h28a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

SCOP Domain Coordinates for d1h28a_:

Click to download the PDB-style file with coordinates for d1h28a_.
(The format of our PDB-style files is described here.)

Timeline for d1h28a_: