SCOP 1.67: Domain d1h28c_: 1h28 C:

Lineage for d1h28c_ (1h28 C:)

1. Root: SCOP 1.67

2. Class d: Alpha and beta proteins (a+b) [53931] (260 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (47 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (2 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (73 PDB entries)

8. Domain d1h28c_: 1h28 C: [76543]
   Other proteins in same PDB: d1h28b1, d1h28b2, d1h28d1, d1h28d2
   complex with cyclin and an 11-residue recruitment peptide from p107
   complexed with tpo

Details for d1h28c_

PDB Entry: 1h28, 2.8 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from p107

SCOP Domain Sequences for d1h28c_:

Sequence; same for both SEQRES and ATOM records:

>d1h28c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl

Timeline for d1h28c_:

• d1h28c_ first appeared in SCOP 1.63
  
• d1h28c_ appears in SCOP 1.65
  
• d1h28c_ appears in SCOP 1.69
  
• d1h28c_ appears in the current release, SCOPe 2.08, called d1h28c1