| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins) |
| Protein Cyclin-dependent PK (CDK, different isozymes) [56114] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [56115] (47 PDB entries) |
| Domain d1h28a_: 1h28 A: [76540] Other proteins in same PDB: d1h28b1, d1h28b2, d1h28d1, d1h28d2 |
PDB Entry: 1h28 (more details), 2.8 Å
SCOP Domain Sequences for d1h28a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h28a_ d.144.1.1 (A:) Cyclin-dependent PK (CDK, different isozymes) {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
Timeline for d1h28a_: