SCOP 1.65: Domain d1h25c_: 1h25 C:

Lineage for d1h25c_ (1h25 C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (41 proteins)
   members organised in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK2 [88855] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88856] (53 PDB entries)

8. Domain d1h25c_: 1h25 C: [76525]
   Other proteins in same PDB: d1h25b1, d1h25b2, d1h25d1, d1h25d2
   complex with cyclin and an 11-residue recruitment peptide from retinoblastoma-associated protein
   complexed with tpo

Details for d1h25c_

PDB Entry: 1h25, 2.5 Å

PDB Description: cdk2/cyclin a in complex with an 11-residue recruitment peptide from retinoblastoma-associated protein

SCOP Domain Sequences for d1h25c_:

Sequence, based on SEQRES records:

>d1h25c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv

Sequence, based on observed residues (ATOM records):

>d1h25c_ d.144.1.7 (C:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens)}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdvvpp
ldedgrsllsqmlhydpnkrisakaalahpffqdvtkpv

Timeline for d1h25c_:

• d1h25c_ first appeared in SCOP 1.63
  
• d1h25c_ appears in SCOP 1.67
  
• d1h25c_ appears in the current release, SCOPe 2.08, called d1h25c1