SCOPe 2.01: Domain d1h24b2: 1h24 B:310-432

Lineage for d1h24b2 (1h24 B:310-432)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin A [47956] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47957] (35 PDB entries)
   Uniprot P20248 175-432

8. Domain d1h24b2: 1h24 B:310-432 [76518]
   Other proteins in same PDB: d1h24a_, d1h24c_

Details for d1h24b2

PDB Entry: 1h24, 2.5 Å

PDB Description: cdk2/cyclin a in complex with a 9 residue recruitment peptide from e2f

PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d1h24b2:

Sequence; same for both SEQRES and ATOM records:

>d1h24b2 a.74.1.1 (B:310-432) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
tvnqfltqyflhqqpanckveslamflgelslidadpylkylpsviagaafhlalytvtg
qswpeslirktgytleslkpclmdlhqtylkapqhaqqsirekyknskyhgvsllnppet
lnl

Timeline for d1h24b2:

• d1h24b2 first appeared in SCOP 1.63
  
• d1h24b2 appears in SCOP 1.75
  
• d1h24b2 appears in SCOPe 2.02
  
• d1h24b2 appears in the current release, SCOPe 2.08