| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Cyclin-dependent PK, CDK2 [88855] (2 species) CMGC group; CDKs subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [88856] (340 PDB entries) Uniprot P24941 |
| Domain d1h1pa_: 1h1p A: [76477] Other proteins in same PDB: d1h1pb1, d1h1pb2, d1h1pd1, d1h1pd2 complexed with cmg |
PDB Entry: 1h1p (more details), 2.1 Å
SCOPe Domain Sequences for d1h1pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1h1pa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]}
smenfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkeln
hpnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafch
shrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgcky
ystavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykps
fpkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphl
Timeline for d1h1pa_: