Lineage for d1gzsa_ (1gzs A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2866774Protein CDC42 [52619] (2 species)
  7. 2866775Species Human (Homo sapiens) [TaxId:9606] [52620] (34 PDB entries)
  8. 2866791Domain d1gzsa_: 1gzs A: [76424]
    Other proteins in same PDB: d1gzsb_, d1gzsd_
    complexed with so4

Details for d1gzsa_

PDB Entry: 1gzs (more details), 2.3 Å

PDB Description: crystal structure of the complex between the gef domain of the salmonella typhimurium sope toxin and human cdc42
PDB Compounds: (A:) GTP-binding protein

SCOPe Domain Sequences for d1gzsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gzsa_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]}
mqtikcvvvgdgavgktcllisyttnkfpseyvptvfdnyavtvmiggepytlglfdtag
qedydrlrplsypqtdvflvcfsvvspssfenvkekwvpeithhcpktpfllvgtqidlr
ddpstieklaknkqkpitpetaeklardlkavkyvecsaltqkglknvfdeailaale

SCOPe Domain Coordinates for d1gzsa_:

Click to download the PDB-style file with coordinates for d1gzsa_.
(The format of our PDB-style files is described here.)

Timeline for d1gzsa_: