SCOPe 2.07: Domain d1gt6b_: 1gt6 B:

Lineage for d1gt6b_ (1gt6 B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.17: Fungal lipases [53558] (5 proteins)

6. Protein Triacylglycerol lipase [53559] (7 species)

7. Species Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId:5541] [53563] (26 PDB entries)

8. Domain d1gt6b_: 1gt6 B: [76343]
   complexed with ola; mutant

Details for d1gt6b_

PDB Entry: 1gt6, 2.2 Å

PDB Description: s146a mutant of thermomyces (humicola) lanuginosa lipase complex with oleic acid

PDB Compounds: (B:) Lipase

SCOPe Domain Sequences for d1gt6b_:

Sequence; same for both SEQRES and ATOM records:

>d1gt6b_ c.69.1.17 (B:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]}
evsqdlfnqfnlfaqysaaaycgknndapagtnitctgnacpevekadatflysfedsgv
gdvtgflaldntnklivlsfrgsrsienwignlnfdlkeindicsgcrghdgftsswrsv
adtlrqkvedavrehpdyrvvftghalggalatvagadlrgngydidvfsygaprvgnra
faefltvqtggtlyrithtndivprlpprefgyshsspeywiksgtlvpvtrndivkieg
idatggnnqpnipdipahlwyfgligtcl

Timeline for d1gt6b_:

• d1gt6b_ first appeared in SCOP 1.63
  
• d1gt6b_ appears in SCOPe 2.06
  
• d1gt6b_ appears in the current release, SCOPe 2.08