| Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
| Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) ![]() |
| Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
| Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
| Species Erwinia chrysanthemi [TaxId:556] [82735] (5 PDB entries) Protease C |
| Domain d1go7p2: 1go7 P:18-258 [76246] Other proteins in same PDB: d1go7p1 complexed with ca, po4, zn; mutant |
PDB Entry: 1go7 (more details), 2.1 Å
SCOP Domain Sequences for d1go7p2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go7p2 d.92.1.6 (P:18-258) Metalloprotease {Erwinia chrysanthemi}
antssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanlt
fkflqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnyt
rdasgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtfthkighalgla
hpgeynagegdpsyndavyaedsyqfsicsywgenetgadynghyggapmiddiaaiqrl
y
Timeline for d1go7p2: