| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
| Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
| Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (2 species) CMGC group; GSK3 subfamily; serine/threonine kinase |
| Species Human (Homo sapiens) [TaxId:9606] [69824] (57 PDB entries) Uniprot P49841 35-383 ! Uniprot P49841 35-384 |
| Domain d1gngb_: 1gng B: [76240] complexed with so4, trs |
PDB Entry: 1gng (more details), 2.6 Å
SCOPe Domain Sequences for d1gngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gngb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari
Timeline for d1gngb_: