Lineage for d1gngb_ (1gng B:)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 262793Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 262794Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 262795Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)
  6. 262920Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
  7. 262921Species Human (Homo sapiens) [TaxId:9606] [69824] (3 PDB entries)
  8. 262923Domain d1gngb_: 1gng B: [76240]
    complexed with ptr, so4, tmn

Details for d1gngb_

PDB Entry: 1gng (more details), 2.6 Å

PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide

SCOP Domain Sequences for d1gngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gngb_ d.144.1.1 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

SCOP Domain Coordinates for d1gngb_:

Click to download the PDB-style file with coordinates for d1gngb_.
(The format of our PDB-style files is described here.)

Timeline for d1gngb_: