SCOP 1.63: Domain d1gngb_: 1gng B:

Lineage for d1gngb_ (1gng B:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (6 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.1: Serine/threonin kinases [56113] (21 proteins)

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (3 PDB entries)

8. Domain d1gngb_: 1gng B: [76240]
   complexed with ptr, so4, tmn

Details for d1gngb_

PDB Entry: 1gng, 2.6 Å

PDB Description: glycogen synthase kinase-3 beta (gsk3) complex with frattide peptide

SCOP Domain Sequences for d1gngb_:

Sequence; same for both SEQRES and ATOM records:

>d1gngb_ d.144.1.1 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens)}
vsrdkdgskvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkv
lqdkrfknrelqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhys
rakqtlpviyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakql
vrgepnvsyicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlv
eiikvlgtptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytpta
rltpleacahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Timeline for d1gngb_:

• d1gngb_ is new in SCOP 1.63
  
• d1gngb_ appears in SCOP 1.65
  
• d1gngb_ appears in the current release, SCOPe 2.08