SCOPe 2.04: Domain d1giqb2: 1giq B:1210-1413

Lineage for d1giqb2 (1giq B:1210-1413)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins)

6. Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species)
   mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component)

7. Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries)

8. Domain d1giqb2: 1giq B:1210-1413 [76227]
   complexed with nai

Details for d1giqb2

PDB Entry: 1giq, 1.8 Å

PDB Description: crystal structure of the enzymatic componet of iota-toxin from clostridium perfringens with nadh

PDB Compounds: (B:) Iota toxin component Ia

SCOPe Domain Sequences for d1giqb2:

Sequence; same for both SEQRES and ATOM records:

>d1giqb2 d.166.1.1 (B:1210-1413) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
sldfkddvskgdlwgkenysdwsnkltpneladvndymrggytainnylisngplnnpnp
eldskvnnienalkltpipsnlivyrrsgpqefgltltspeydfnkienidafkekwegk
vitypnfistsigsvnmsafakrkiilrinipkdspgaylsaipgyageyevllnhgskf
kinkvdsykdgtvtklildatlin

Timeline for d1giqb2:

• d1giqb2 first appeared in SCOP 1.63
  
• d1giqb2 appears in SCOPe 2.03
  
• d1giqb2 appears in SCOPe 2.05
  
• d1giqb2 appears in the current release, SCOPe 2.08