| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
| Family d.166.1.1: ADP-ribosylating toxins [56400] (10 proteins) |
| Protein Enzymatic component (Ia) of iota-toxin [82812] (1 species) mammalian-targeted relative of VIP2; C-terminal domain is catalytic, N-terminal domain interacts with Ib (binding component) |
| Species Clostridium perfringens [TaxId:1502] [82813] (3 PDB entries) |
| Domain d1giqb1: 1giq B:1003-1209 [76226] complexed with nai |
PDB Entry: 1giq (more details), 1.8 Å
SCOPe Domain Sequences for d1giqb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1giqb1 d.166.1.1 (B:1003-1209) Enzymatic component (Ia) of iota-toxin {Clostridium perfringens [TaxId: 1502]}
ierpedflkdkenaiqwekkeaerveknldtlekealelykkdseqisnysqtrqyfydy
qiesnprekeyknlrnaisknkidkpinvyyfespekfafnkeirtenqneislekfnel
ketiqdklfkqdgfkdvslyepgngdekptpllihlklpkntgmlpyinsndvktlieqd
ysikidkivriviegkqyikaeasivn
Timeline for d1giqb1: